BlastOutput.iterations.E.
Invalid value(s) [9] in VisibleString [AGO_S073922.1_geneid.geneid 2 exon (s) 261 – 281 6 aa, chain – incompleted …]
[blastall] ERROR: 20110903163100/t1.fna.blast.m7Output
BlastOutput.iterations.E.
Invalid value(s) [9] in VisibleString [AGO_S020563.1_geneid.geneid 2 exon (s) 1646 – 1669 6 aa, chain + incompleted …]
[blastall] ERROR: 20110903163100/t1.fna.blast.m7Output
BlastOutput.iterations.E.
Invalid value(s) [9] in VisibleString [AGO_S075634.1_geneid.geneid 2 exon (s) 252 – 287 10 aa, chain – incompleted …]
[blastall] ERROR: 20110903163100/t1.fna.blast.m7Output
BlastOutput.iterations.E.
Invalid value(s) [9] in VisibleString [AGO_S073717.1_geneid.geneid 2 exon (s) 408 – 437 8 aa, chain + incompleted …]
[blastall] ERROR: 20110903163100/t1.fna.blast.m7Output
BlastOutput.iterations.E.
Invalid value(s) [9] in VisibleString [AGO_S026839.1_geneid.geneid 2 exon (s) 412 – 465 16 aa, chain + incompleted …]
这是由于输入序列
>AGO_S001155.6_fgenesh.fgenesh 3 exon (s) 16076 – 17170 256 aa, chain –
MNAPEHTQKIVGAYLSDRKIQFTVGHEKKEFRVEAGVPQGSVIGPCLWNVMYNGLLKQKL
PEDVKIIAFADNVAVVATEWHKNFLEEAFGIVEEWMQKNGLTLAEHKTKVIVFTTRYTQK
NIKVRKHDAGQRRRKLLSCVMTSKLLYGAPCWAERMTTTIIRTVCSYRTVSHDAIAVVFT
DAFKDPVPNGTWDFWQVPLSILVKKYGQMPTLWIIPRYARACLFRVRRVVEAKARTSGIR
WRTNKGREYREIKDSE
>AGO_S057486.1_fgenesh.fgenesh 1 exon (s) 561 – 755 64 aa, chain +
MKMEVAADQAKLALSNVGDYGSTGLRTNKLIENRLKNVCMQIKNNDISILDFLMVVSHIR
KQCY
含有\t空格。标准fasta 格式要去掉
awk ‘{print $1}’ aphis_geneid_fgenesh_augustus.pep > aphis_geneid_fgenesh_augustus.pep.fasta 得到标准格式
shenzy@node5:/public/d_aphis/DNA_assembly/3.1fix/gene_predict/annotation/uniprot2$ head aphis_geneid_fgenesh_augustus.pep.fasta
>AGO_S001155.6_fgenesh.fgenesh
MNAPEHTQKIVGAYLSDRKIQFTVGHEKKEFRVEAGVPQGSVIGPCLWNVMYNGLLKQKL
PEDVKIIAFADNVAVVATEWHKNFLEEAFGIVEEWMQKNGLTLAEHKTKVIVFTTRYTQK
NIKVRKHDAGQRRRKLLSCVMTSKLLYGAPCWAERMTTTIIRTVCSYRTVSHDAIAVVFT
DAFKDPVPNGTWDFWQVPLSILVKKYGQMPTLWIIPRYARACLFRVRRVVEAKARTSGIR
WRTNKGREYREIKDSE
>AGO_S057486.1_fgenesh.fgenesh
MKMEVAADQAKLALSNVGDYGSTGLRTNKLIENRLKNVCMQIKNNDISILDFLMVVSHIR
KQCY
I simply wanted to send a small word to be able to appreciate you for the remarkable pointers you are posting at this site. My time intensive internet search has at the end been paid with reputable suggestions to share with my classmates and friends. I would claim that many of us visitors actually are very much endowed to live in a remarkable website with very many wonderful individuals with very helpful advice. I feel very lucky to have discovered your website page and look forward to plenty of more entertaining minutes reading here. Thanks a lot once more for all the details.
:)Thanks for coming my blog! It’s my pleasure to receive some positive feedback!
Works well! It is not obvious, thuogh. Will new users know to click on the yellow bubble or time stamp?Within the thread itself, perhaps you can put the same yellow bubble next to the title of the thread to keep things consistent? Maybe a yellow bubble with a down arrow?
Linds Posted on my only thought on the color scehme is Jesus loves His enemies? swell pics, bro very swell. (ps- you should feel special. your blog is pretty much the only one i ever check regularly.)
What i don’t realize is in reality how you’re not really a lot more smartly-preferred than you may be right now. You’re so intelligent. You recognize therefore significantly when it comes to this topic, made me in my view believe it from a lot of varied angles. Its like men and women don’t seem to be interested until it’s one thing to do with Woman gaga! Your personal stuffs excellent. At all times handle it up!
Posted on incredible, that was a very good read. In cocnlusion, someone who actually thinks and understands what they are blogging about. Quite difficult to find of late, especially on the web . I bookmarked your web blog and will make sure to keep coming back here if this is how you always write. thank you, keep it up! .
Ok, i will keep it up
Focus on required really effective affiliate business how you’ll be able to keep within managing strategies very good for your good web-based provider. alertpay
I like the valuable info you supply on your articles. I’ll bookmark your blog and take a look at once more right here regularly. I am reasonably sure I will be told lots of new stuff right here! Good luck for the next!
A large percentage of of the things you state is supprisingly precise and that makes me ponder why I hadn’t looked at this with this light before. Your article truly did turn the light on for me personally as far as this particular issue goes. But at this time there is one particular factor I am not really too comfortable with and while I attempt to reconcile that with the actual central theme of the position, let me see just what the rest of your visitors have to say.Very well done.
One other issue issue is that video games usually are serious anyway with the most important focus on finding out rather than leisure. Although, it has an entertainment part to keep your sons or daughters engaged, every single game is frequently designed to develop a specific group of skills or course, such as instructional math or science. Thanks for your article.
Woah! I’m really digging the template/theme of this website. It’s simple, yet effective. A lot of times it’s very difficult to get that “perfect balance” between superb usability and visual appeal. I must say you’ve done a superb job with this. In addition, the blog loads extremely quick for me on Chrome. Excellent Blog!
Do you have a spam problem on this blog; I also am a blogger, and I was wondering your situation; many of us have created some nice methods and we are looking to exchange techniques with others, please shoot me an e-mail if interested.
I absolutely love your blog and find nearly all of your post’s to be exactly what I’m looking for. Does one offer guest writers to write content to suit your needs? I wouldn’t mind producing a post or elaborating on a number of the subjects you write regarding here. Again, awesome weblog!
Thanks for coming my blog
Have you ever considered writing an e-book or guest authoring on other sites? I have a blog centered on the same topics you discuss and would really like to have you share some stories/information. I know my readers would enjoy your work. If you are even remotely interested, feel free to send me an e-mail.
OK, i will contact to u when i intend to write an e-book! thanks
Hi! I could have sworn I’ve been to this site before but after browsing through some of the post I realized it’s new to me. Anyhow, I’m definitely delighted I found it and I’ll be book-marking and checking back often!
Thanks for ur coming
With havin so much content and articles do you ever run into any issues of plagorism or copyright violation? My site has a lot of unique content I’ve either authored myself or outsourced but it appears a lot of it is popping it up all over the web without my permission. Do you know any solutions to help protect against content from being stolen? I’d truly appreciate it.
Sorry, i have no idea! But i am sure that anybody can do copy ur articles to anywhere, if they just said that’s forwarding and given the original link, It’s OK!
hello!,I love your writing very so much! proportion we be in contact more about your article on AOL? I need an expert on this area to resolve my problem. May be that is you! Looking forward to look you.
I liked up to you will receive carried out proper here. The comic strip is tasteful, your authored subject matter stylish. nevertheless, you command get bought an edginess over that you want be delivering the following. unwell indisputably come more previously again since exactly the same nearly a lot steadily inside case you shield this increase.
Appreciate it for helping out, great information. “In case of dissension, never dare to judge till you’ve heard the other side.” by Euripides.
Yeah bookmaking this wasn’t a risky determination great post!
Nice blog! Is your theme custom made or did you download it from somewhere? A design like yours with a few simple adjustements would really make my blog stand out. Please let me know where you got your design. With thanks
Just download the newest version of wordpress and then u can find the default theme
But wanna state that this is handy , Thanks for taking your time to write this.
Extremely well-run web log, if you are a of products that produces right up prefer to return the following! Stay the best. Site saved in my top features!
I like this web site because so much utile stuff on here.
Merely hadn’t noticed it again I would not own thought that you will find functions who seem to possess many of these terrific subject material. Values online and private blogs, may be refurbished!
I’ve said that least 4203421 times. SCK was here
I am impressed with this website , very I am a big fan .
Unquestionably consider that that you stated. Your favorite justification seemed to be at the net the easiest thing to bear in mind of. I say to you, I certainly get irked even as folks consider concerns that they plainly don’t realize about. You managed to hit the nail upon the top and defined out the entire thing with no need side-effects , other people could take a signal. Will likely be back to get more. Thank you!
I and also my pals were found to be checking the best helpful hints found on your web page while quickly developed an awful suspicion I had not expressed respect to you for those tips. All of the young boys became absolutely passionate to read through all of them and have really been having fun with them. Many thanks for really being so helpful as well as for deciding upon such good issues most people are really needing to know about. My very own honest regret for not expressing appreciation to earlier.
I like this web site very much, Its a very nice place to read and incur information.
Thanks
I was curious if you ever considered changing the structure of your site? Its very well written; I love what youve got to say. But maybe you could a little more in the way of content so people could connect with it better. Youve got an awful lot of text for only having one or 2 pictures. Maybe you could space it out better?
I merely wanted to thank you once more for your amazing web page you have created here. It’s full of ideas for those who are really interested in this subject, primarily this very post. Your all amazingly sweet and also thoughtful of others in addition to the fact that reading the blog posts is a wonderful delight in my opinion. And what generous present! Mary and I really have excitement making use of your ideas in what we have to do next week. Our checklist is a kilometer long and tips will be put to fine use.
Only a smiling visitant here to share the love (:, btw outstanding pattern .
Some truly wondrous work on behalf of the owner of this site, utterly outstanding written content.
I’m truly enjoying the design and layout of your website. It’s a very easy on the eyes which makes it much more enjoyable for me to come here and visit more often. Did you hire out a developer to create your theme? Excellent work!
Hello are using WordPress for your blog platform? I’m new to the blog world but I’m trying to get started and set up my own. Do you need any html coding knowledge to make your own blog? Any help would be really appreciated!
Someone essentially assist to make seriously articles I’d state. This is the very first time I frequented your web page and to this point? I surprised with the analysis you made to make this particular submit amazing. Great task!
I genuinely enjoy studying on this website, it holds wonderful blog posts. “Don’t put too fine a point to your wit for fear it should get blunted.” by Miguel de Cervantes.
Very interesting info !Perfect just what I was searching for! “If you want to test your memory, try to recall what you were worrying about one year ago today.” by Rotarian.
I have read some excellent stuff here. Definitely worth bookmarking for revisiting. I wonder how a lot attempt you put to make this kind of fantastic informative web site.
hi!,I love your writing very so much! proportion we be in contact extra approximately your article on AOL? I require a specialist on this space to unravel my problem. May be that’s you! Looking forward to see you.
But a smiling visitor here to share the love (:, btw great design and style .
It is in reality a nice and useful piece of info. I am glad that you simply shared this useful info with us. Please keep us up to date like this. Thank you for sharing.
Some truly great articles on this website , thanks for contribution.
I really like your writing style, good information, appreciate it for putting up : D.
Some really prize blog posts on this internet site , saved to bookmarks .
I like this weblog its a master peace ! Glad I found this on google. “Observe your enemies, for they first find out your faults.” by Antisthenes.
As soon as I observed this web site I went on reddit to share some of the love with them.
I enjoy the efforts you have put in this, regards for all the great blog posts.
This is really attention-grabbing, You are a very professional blogger. I have joined your rss feed and look forward to seeking more of your magnificent post. Also, I’ve shared your site in my social networks!
I have recently started a site, the info you offer on this web site has helped me greatly. Thank you for all of your time & work. “It is no use saying, ‘We are doing our best.’ You have got to succeed in doing what is necessary.” by Sir Winston Churchill.
I think this internet site contains very excellent pent subject matter posts.
Whats up very cool web site!! Guy .. Beautiful .. Amazing .. I will bookmark your website and take the feeds also…I am glad to find a lot of helpful info right here in the submit, we want work out extra techniques on this regard, thanks for sharing.
Thank you for sharing excellent informations. Your web-site is very cool. I’m impressed by the details that you have on this blog. It reveals how nicely you understand this subject. Bookmarked this web page, will come back for more articles. You, my friend, ROCK! I found simply the info I already searched everywhere and simply could not come across. What an ideal site.
Thank you for the good writeup. It if truth be told was once a enjoyment account it. Look advanced to more delivered agreeable from you! However, how can we communicate?
This web page is mostly a walk-through for all of the info you wanted about this and didn’t know who to ask. Glimpse right here, and you’ll definitely discover it.
Hello, you used to write wonderful, but the last few posts have been kinda boring¡K I miss your super writings. Past few posts are just a little out of track! come on!
Hey There. I found your blog using msn. This is a very well written article. I will be sure to bookmark it and come back to read more of your useful information. Thanks for the post. I’ll definitely return.
I absolutely love your blog and find almost all of your post’s to be what precisely I’m looking for. can you offer guest writers to write content available for you? I wouldn’t mind writing a post or elaborating on a number of the subjects you write about here. Again, awesome web site!
I have to express my passion for your kindness in support of persons that really need help on this particular area. Your personal commitment to passing the solution throughout had been particularly useful and has specifically encouraged others much like me to arrive at their pursuits. Your new valuable report denotes a great deal to me and further more to my colleagues. Thank you; from everyone of us.
You made some decent points there. I looked on the internet for the topic and found most individuals will go along with with your blog.
Regards for helping out, good information. “Those who restrain desire, do so because theirs is weak enough to be restrained.” by William Blake.
I like this post, enjoyed this one thanks for putting up.
Dead written articles, thank you for selective information. “The bravest thing you can do when you are not brave is to profess courage and act accordingly.” by Corra Harris.